Lineage for d1h3na2 (1h3n A:226-417)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798370Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1798371Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1798372Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 1798388Protein Leucyl-tRNA synthetase (LeuRS) [82133] (1 species)
    in the prokaryotic and mitochondrial LeuRS this domain is inserted into a different sequential position
  7. 1798389Species Thermus thermophilus [TaxId:274] [82134] (3 PDB entries)
  8. 1798390Domain d1h3na2: 1h3n A:226-417 [76642]
    Other proteins in same PDB: d1h3na1, d1h3na3
    protein/RNA complex; complexed with leu, lms, so4, zn

Details for d1h3na2

PDB Entry: 1h3n (more details), 2 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a sulphamoyl analogue of leucyl-adenylate
PDB Compounds: (A:) leucyl-tRNA synthetase

SCOPe Domain Sequences for d1h3na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3na2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
rsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapekreevlayve
aakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdq
rdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawl
eekglgkgrvty

SCOPe Domain Coordinates for d1h3na2:

Click to download the PDB-style file with coordinates for d1h3na2.
(The format of our PDB-style files is described here.)

Timeline for d1h3na2: