Lineage for d1h3na1 (1h3n A:687-814)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993200Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1993201Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1993202Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1993226Protein Leucyl-tRNA synthetase (LeuRS) [81746] (1 species)
  7. 1993227Species Thermus thermophilus [TaxId:274] [81747] (3 PDB entries)
  8. 1993228Domain d1h3na1: 1h3n A:687-814 [76641]
    Other proteins in same PDB: d1h3na2, d1h3na3
    The C-terminal region (residues 815-878) is invisible in the electron density
    protein/RNA complex; complexed with leu, lms, so4, zn

Details for d1h3na1

PDB Entry: 1h3n (more details), 2 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a sulphamoyl analogue of leucyl-adenylate
PDB Compounds: (A:) leucyl-tRNA synthetase

SCOPe Domain Sequences for d1h3na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3na1 a.27.1.1 (A:687-814) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
flnriyrrvaedrealletsgvfqaealegkdrelygklhetlkkvtedlealrfntaia
almeflnalyeyrkdrpvtpvyrtairyylqmlfpfaphlaeelwhwfwpdslfeagwpe
ldekalek

SCOPe Domain Coordinates for d1h3na1:

Click to download the PDB-style file with coordinates for d1h3na1.
(The format of our PDB-style files is described here.)

Timeline for d1h3na1: