SCOPe 2.05: Domain d1h3na1: 1h3n A:687-814

Lineage for d1h3na1 (1h3n A:687-814)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Leucyl-tRNA synthetase (LeuRS) [81746] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81747] (3 PDB entries)

8. Domain d1h3na1: 1h3n A:687-814 [76641]
   Other proteins in same PDB: d1h3na2, d1h3na3
   The C-terminal region (residues 815-878) is invisible in the electron density
   protein/RNA complex; complexed with leu, lms, so4, zn

Details for d1h3na1

PDB Entry: 1h3n, 2 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a sulphamoyl analogue of leucyl-adenylate

PDB Compounds: (A:) leucyl-tRNA synthetase

SCOPe Domain Sequences for d1h3na1:

Sequence; same for both SEQRES and ATOM records:

>d1h3na1 a.27.1.1 (A:687-814) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
flnriyrrvaedrealletsgvfqaealegkdrelygklhetlkkvtedlealrfntaia
almeflnalyeyrkdrpvtpvyrtairyylqmlfpfaphlaeelwhwfwpdslfeagwpe
ldekalek

Timeline for d1h3na1:

• d1h3na1 first appeared in SCOP 1.63
  
• d1h3na1 appears in SCOPe 2.04
  
• d1h3na1 appears in SCOPe 2.06
  
• d1h3na1 appears in the current release, SCOPe 2.08