Lineage for d1h3la_ (1h3l A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 287020Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 287021Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 287022Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (4 proteins)
  6. 287027Protein Sigma factor SigR [81883] (1 species)
  7. 287028Species Streptomyces coelicolor a3(2) [TaxId:100226] [81884] (1 PDB entry)
  8. 287029Domain d1h3la_: 1h3l A: [76639]

Details for d1h3la_

PDB Entry: 1h3l (more details), 2.37 Å

PDB Description: n-terminal fragment of sigr from streptomyces coelicolor

SCOP Domain Sequences for d1h3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3la_ a.177.1.1 (A:) Sigma factor SigR {Streptomyces coelicolor a3(2)}
staersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfregtnlka
wlyriltntfinsyr

SCOP Domain Coordinates for d1h3la_:

Click to download the PDB-style file with coordinates for d1h3la_.
(The format of our PDB-style files is described here.)

Timeline for d1h3la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h3lb_