Lineage for d1h3la_ (1h3l A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216884Fold a.112: RNA polymerase sigma subunit [48328] (1 superfamily)
    multihelical; consists of several all-alpha subdomains
  4. 216885Superfamily a.112.1: RNA polymerase sigma subunit [48329] (1 family) (S)
  5. 216886Family a.112.1.1: RNA polymerase sigma subunit [48330] (4 proteins)
  6. 216894Protein Sigma factor SigR fragment [81883] (1 species)
    anti-sigma factor binding domain
  7. 216895Species Streptomyces coelicolor a3(2) [TaxId:100226] [81884] (1 PDB entry)
  8. 216896Domain d1h3la_: 1h3l A: [76639]

Details for d1h3la_

PDB Entry: 1h3l (more details), 2.37 Å

PDB Description: n-terminal fragment of sigr from streptomyces coelicolor

SCOP Domain Sequences for d1h3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3la_ a.112.1.1 (A:) Sigma factor SigR fragment {Streptomyces coelicolor a3(2)}
staersarferdalefldqmysaalrmtrnpadaedlvqetyakayasfhqfregtnlka
wlyriltntfinsyr

SCOP Domain Coordinates for d1h3la_:

Click to download the PDB-style file with coordinates for d1h3la_.
(The format of our PDB-style files is described here.)

Timeline for d1h3la_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h3lb_