Lineage for d1h3ib2 (1h3i B:194-344)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818606Superfamily b.85.7: SET domain [82199] (4 families) (S)
    duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII
    also contains a substrate-binding alpha+beta subdomain inserted in the core
    Pfam PF00856
  5. 2818607Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins)
    contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains
  6. 2818613Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species)
  7. 2818614Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries)
    Uniprot Q8WTS6 52-336
  8. 2818626Domain d1h3ib2: 1h3i B:194-344 [76638]
    Other proteins in same PDB: d1h3ia1, d1h3ib1
    complexed with mg

Details for d1h3ib2

PDB Entry: 1h3i (more details), 2.1 Å

PDB Description: crystal structure of the histone methyltransferase set7/9
PDB Compounds: (B:) histone h3 lysine 4 specific methyltransferase

SCOPe Domain Sequences for d1h3ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ib2 b.85.7.1 (B:194-344) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgk

SCOPe Domain Coordinates for d1h3ib2:

Click to download the PDB-style file with coordinates for d1h3ib2.
(The format of our PDB-style files is described here.)

Timeline for d1h3ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ib1