Lineage for d1h3ib1 (1h3i B:52-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813016Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2813072Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 2813073Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 2813074Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 2813075Species Human (Homo sapiens) [TaxId:9606] [82188] (19 PDB entries)
    Uniprot Q8WTS6 52-366
  8. 2813087Domain d1h3ib1: 1h3i B:52-193 [76637]
    Other proteins in same PDB: d1h3ia2, d1h3ib2
    complexed with mg

Details for d1h3ib1

PDB Entry: 1h3i (more details), 2.1 Å

PDB Description: crystal structure of the histone methyltransferase set7/9
PDB Compounds: (B:) histone h3 lysine 4 specific methyltransferase

SCOPe Domain Sequences for d1h3ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ib1 b.76.2.1 (B:52-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fffdgstlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqyk
dnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklat
lmsteegrphfelmpgnsvyhf

SCOPe Domain Coordinates for d1h3ib1:

Click to download the PDB-style file with coordinates for d1h3ib1.
(The format of our PDB-style files is described here.)

Timeline for d1h3ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ib2