| Class b: All beta proteins [48724] (180 folds) |
| Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.7: SET domain [82199] (4 families) ![]() duplication: the core is composed of two structural repeats similar to (circularly permuted) repeats of AFPIII also contains a substrate-binding alpha+beta subdomain inserted in the core Pfam PF00856 |
| Family b.85.7.1: Histone lysine methyltransferases [82200] (3 proteins) contains metal-binding preSET (Pfam PF05033) or AWS (Associated With SET, Pfam PF17907), and postSET domains |
| Protein Histone H3 K4-specific methyltransferase SET7/9 catalytic domain [82205] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [82206] (19 PDB entries) Uniprot Q8WTS6 52-336 |
| Domain d1h3ia2: 1h3i A:194-344 [76636] Other proteins in same PDB: d1h3ia1, d1h3ib1 complexed with mg |
PDB Entry: 1h3i (more details), 2.1 Å
SCOPe Domain Sequences for d1h3ia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ia2 b.85.7.1 (A:194-344) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
dkstsscistnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithq
evdsrdwalngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprf
gpikcirtlraveadeeltvaygydhsppgk
Timeline for d1h3ia2: