Lineage for d1h3ia1 (1h3i A:52-193)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470039Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 470050Superfamily b.76.2: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82185] (1 family) (S)
    11+ stranded sheet partly folded upon itself at the C-end
  5. 470051Family b.76.2.1: Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82186] (1 protein)
  6. 470052Protein Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain [82187] (1 species)
  7. 470053Species Human (Homo sapiens) [TaxId:9606] [82188] (6 PDB entries)
  8. 470054Domain d1h3ia1: 1h3i A:52-193 [76635]
    Other proteins in same PDB: d1h3ia2, d1h3ib2

Details for d1h3ia1

PDB Entry: 1h3i (more details), 2.1 Å

PDB Description: crystal structure of the histone methyltransferase set7/9

SCOP Domain Sequences for d1h3ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ia1 b.76.2.1 (A:52-193) Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain {Human (Homo sapiens)}
fffdgstlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqyk
dnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklat
lmsteegrphfelmpgnsvyhf

SCOP Domain Coordinates for d1h3ia1:

Click to download the PDB-style file with coordinates for d1h3ia1.
(The format of our PDB-style files is described here.)

Timeline for d1h3ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3ia2