SCOP 1.73: Domain d1h3fb2: 1h3f B:353-432

Lineage for d1h3fb2 (1h3f B:353-432)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.4: Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75465] (1 protein)
   there are additional N-terminal structures

6. Protein Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75466] (2 species)

7. Species Thermus thermophilus [TaxId:274] [82701] (2 PDB entries)

8. Domain d1h3fb2: 1h3f B:353-432 [76634]
   Other proteins in same PDB: d1h3fa1, d1h3fb1
   complexed with so4, tyb

Details for d1h3fb2

PDB Entry: 1h3f, 2 Å

PDB Description: tyrosyl-trna synthetase from thermus thermophilus complexed with tyrosinol

PDB Compounds: (B:) Tyrosyl-tRNA synthetase

SCOP Domain Sequences for d1h3fb2:

Sequence; same for both SEQRES and ATOM records:

>d1h3fb2 d.66.1.4 (B:353-432) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Thermus thermophilus [TaxId: 274]}
eipevtipaselkegriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvdl
srprilqrgkdrfvrvrlsd

Timeline for d1h3fb2:

• d1h3fb2 first appeared in SCOP 1.63
  
• d1h3fb2 appears in SCOP 1.71
  
• d1h3fb2 appears in SCOP 1.75
  
• d1h3fb2 appears in the current release, SCOPe 2.08