Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) common motif in otherwise different folds |
Family d.66.1.4: Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75465] (1 protein) there are additional N-terminal structures |
Protein Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain [75466] (2 species) |
Species Thermus thermophilus [TaxId:274] [82701] (2 PDB entries) |
Domain d1h3ea2: 1h3e A:352-432 [76630] Other proteins in same PDB: d1h3ea1 complexed with atp, mad, psu, rt, tyb |
PDB Entry: 1h3e (more details), 2.9 Å
SCOP Domain Sequences for d1h3ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ea2 d.66.1.4 (A:352-432) Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain {Thermus thermophilus [TaxId: 274]} eeipevtipaselkegriwvarlftlagltpsnaearrliqnrglrldgevltdpmlqvd lsrprilqrgkdrfvrvrlsd
Timeline for d1h3ea2: