Lineage for d1h34a_ (1h34 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258855Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2258856Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2258857Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 2258866Species Lima bean (Phaseolus lunatus) [TaxId:3884] [82893] (1 PDB entry)
  8. 2258867Domain d1h34a_: 1h34 A: [76624]

Details for d1h34a_

PDB Entry: 1h34 (more details), 2.04 Å

PDB Description: crystal structure of lima bean trypsin inhibitor
PDB Compounds: (A:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d1h34a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h34a_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Lima bean (Phaseolus lunatus) [TaxId: 3884]}
kpccdhcsctksippqcrctdlrldschsackscictlsipaqcvcddiddfcyepc

SCOPe Domain Coordinates for d1h34a_:

Click to download the PDB-style file with coordinates for d1h34a_.
(The format of our PDB-style files is described here.)

Timeline for d1h34a_: