![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Lima bean (Phaseolus lunatus) [TaxId:3884] [82893] (1 PDB entry) |
![]() | Domain d1h34a_: 1h34 A: [76624] |
PDB Entry: 1h34 (more details), 2.04 Å
SCOPe Domain Sequences for d1h34a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h34a_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Lima bean (Phaseolus lunatus) [TaxId: 3884]} kpccdhcsctksippqcrctdlrldschsackscictlsipaqcvcddiddfcyepc
Timeline for d1h34a_: