SCOPe 2.01: Domain d1h34a_: 1h34 A:

Lineage for d1h34a_ (1h34 A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Lima bean (Phaseolus lunatus) [TaxId:3884] [82893] (1 PDB entry)

8. Domain d1h34a_: 1h34 A: [76624]

Details for d1h34a_

PDB Entry: 1h34, 2.04 Å

PDB Description: crystal structure of lima bean trypsin inhibitor

PDB Compounds: (A:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d1h34a_:

Sequence; same for both SEQRES and ATOM records:

>d1h34a_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Lima bean (Phaseolus lunatus) [TaxId: 3884]}
kpccdhcsctksippqcrctdlrldschsackscictlsipaqcvcddiddfcyepc

Timeline for d1h34a_:

• d1h34a_ first appeared in SCOP 1.63
  
• d1h34a_ appears in SCOP 1.75
  
• d1h34a_ appears in SCOPe 2.02
  
• d1h34a_ appears in the current release, SCOPe 2.08