Lineage for d1h31c1 (1h31 C:1-150)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532347Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 532348Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 532765Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
    two-domain cytochrome c with novel domain arrangement
  6. 532766Protein Di-heme cytochrome c SoxA [81678] (1 species)
    cysteine persulfide(cys sulfane) heme coordination
  7. 532767Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (3 PDB entries)
  8. 532774Domain d1h31c1: 1h31 C:1-150 [76609]
    Other proteins in same PDB: d1h31b_, d1h31d_, d1h31f_, d1h31h_

Details for d1h31c1

PDB Entry: 1h31 (more details), 2.55 Å

PDB Description: Oxidised SoxAX complex from Rhodovulum sulfidophilum

SCOP Domain Sequences for d1h31c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h31c1 a.3.1.8 (C:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum}
gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
apewdyigpdmtamvaliasvsrgmpvsva

SCOP Domain Coordinates for d1h31c1:

Click to download the PDB-style file with coordinates for d1h31c1.
(The format of our PDB-style files is described here.)

Timeline for d1h31c1: