Lineage for d1h30a2 (1h30 A:461-678)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663826Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 663838Protein Growth-arrest-specific protein Gas6 [82036] (1 species)
  7. 663839Species Human (Homo sapiens) [TaxId:9606] [82037] (1 PDB entry)
  8. 663841Domain d1h30a2: 1h30 A:461-678 [76605]
    complexed with ca, so4

Details for d1h30a2

PDB Entry: 1h30 (more details), 2.2 Å

PDB Description: c-terminal lg domain pair of human gas6
PDB Compounds: (A:) growth-arrest-specific protein

SCOP Domain Sequences for d1h30a2:

Sequence, based on SEQRES records: (download)

>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]}
tvkvntrmqcfsvtergsfypgsgfafysldymrtpldvgtestwevevvahirpaadtg
vlfalwapdlravplsvalvdyhstkklkkqlvvlavehtalalmeikvcdgqehvvtvs
lrdgeatlevdgtrgqsevsaaqlqerlavlerhlrspvltfagglpdvpvtsapvtafy
rgcmtlevnrrlldldeaaykhsditahscppvepaaa

Sequence, based on observed residues (ATOM records): (download)

>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]}
tvkvntrmqcfsvtergsfypgsgfafysldymrstwevevvahirpaadtgvlfalwap
dlravplsvalvdyhkkqlvvlavehtalalmeikvcdgqehvvtvslrdgeatlevdgt
rgqsevsaaqlqerlavlerhlrspvltfagglpdvpvtsapvtafyrgcmtlevnrrll
dldeaaykhsditahscppvepaaa

SCOP Domain Coordinates for d1h30a2:

Click to download the PDB-style file with coordinates for d1h30a2.
(The format of our PDB-style files is described here.)

Timeline for d1h30a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h30a1