Lineage for d1h30a1 (1h30 A:261-451)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043221Family b.29.1.4: Laminin G-like module [49944] (7 protein domains)
  6. 2043233Protein Growth-arrest-specific protein Gas6 [82036] (1 species)
  7. 2043234Species Human (Homo sapiens) [TaxId:9606] [82037] (1 PDB entry)
  8. 2043235Domain d1h30a1: 1h30 A:261-451 [76604]
    complexed with ca, so4

Details for d1h30a1

PDB Entry: 1h30 (more details), 2.2 Å

PDB Description: c-terminal lg domain pair of human gas6
PDB Compounds: (A:) growth-arrest-specific protein

SCOPe Domain Sequences for d1h30a1:

Sequence, based on SEQRES records: (download)

>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]}
hcdgrgglklsqdmdtcedilpcvpfsvaksvkslylgrmfsgtpvirlrfkrlqptrlv
aefdfrtfdpegillfagghqdstwivlalragrlelqlryngvgrvtssgpvinhgmwq
tisveelarnlvikvnrdavmkiavagdlfqperglyhlnltvggipfhekdlvqpinpr
ldgcmrswnwl

Sequence, based on observed residues (ATOM records): (download)

>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]}
hcdgrgglklsqdmdtcedilpcvpfsvaksvkslylgrpvirlrfkrlqptrlvaefdf
rtfdpegillfagghqdstwivlalragrlelqlryngvgrvtssgpvinhgmwqtisve
elarnlvikvnrdavmkiavagdlfqperglyhlnltvggipfhekdlvqpinprldgcm
rswnwl

SCOPe Domain Coordinates for d1h30a1:

Click to download the PDB-style file with coordinates for d1h30a1.
(The format of our PDB-style files is described here.)

Timeline for d1h30a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h30a2