Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins) N-terminal domain is a 7-bladed beta-propeller automatically mapped to Pfam PF00326 |
Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [53498] (27 PDB entries) Uniprot P23687 |
Domain d1h2ya2: 1h2y A:431-710 [76601] Other proteins in same PDB: d1h2ya1 complexed with gol, zpr; mutant |
PDB Entry: 1h2y (more details), 1.78 Å
SCOPe Domain Sequences for d1h2ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2ya2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygfggfnisitpnysvsrli fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl lihvdtkaghgagkptakvieevsdmfafiarclnidwip
Timeline for d1h2ya2: