SCOP 1.75: Domain d1h2ya1: 1h2y A:1-430

Lineage for d1h2ya1 (1h2y A:1-430)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families)

5. Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein)

6. Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries)
   Uniprot P23687

8. Domain d1h2ya1: 1h2y A:1-430 [76600]
   Other proteins in same PDB: d1h2ya2
   complexed with gol, zpr; mutant

Details for d1h2ya1

PDB Entry: 1h2y, 1.78 Å

PDB Description: prolyl oligopeptidase from porcine brain, y473f mutant with covalently bound inhibitor z-pro-prolinal

PDB Compounds: (A:) prolyl endopeptidase

SCOP Domain Sequences for d1h2ya1:

Sequence; same for both SEQRES and ATOM records:

>d1h2ya1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

Timeline for d1h2ya1:

• d1h2ya1 first appeared in SCOP 1.63
  
• d1h2ya1 appears in SCOP 1.73
  
• d1h2ya1 appears in SCOPe 2.01
  
• d1h2ya1 appears in the current release, SCOPe 2.08