Lineage for d1h2ya1 (1h2y A:1-430)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066277Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2066278Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (2 protein domains)
    automatically mapped to Pfam PF02897
  6. 2066279Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 2066280Species Pig (Sus scrofa) [TaxId:9823] [50996] (27 PDB entries)
    Uniprot P23687
  8. 2066295Domain d1h2ya1: 1h2y A:1-430 [76600]
    Other proteins in same PDB: d1h2ya2
    complexed with gol, zpr; mutant

Details for d1h2ya1

PDB Entry: 1h2y (more details), 1.78 Å

PDB Description: prolyl oligopeptidase from porcine brain, y473f mutant with covalently bound inhibitor z-pro-prolinal
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d1h2ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ya1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

SCOPe Domain Coordinates for d1h2ya1:

Click to download the PDB-style file with coordinates for d1h2ya1.
(The format of our PDB-style files is described here.)

Timeline for d1h2ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h2ya2