Lineage for d1h2xa1 (1h2x A:1-430)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565655Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 565803Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (2 families) (S)
  5. 565804Family b.69.7.1: Prolyl oligopeptidase, N-terminal domain [50994] (1 protein)
  6. 565805Protein Prolyl oligopeptidase, N-terminal domain [50995] (1 species)
  7. 565806Species Pig (Sus scrofa) [TaxId:9823] [50996] (16 PDB entries)
  8. 565810Domain d1h2xa1: 1h2x A:1-430 [76598]
    Other proteins in same PDB: d1h2xa2
    complexed with gol; mutant

Details for d1h2xa1

PDB Entry: 1h2x (more details), 1.49 Å

PDB Description: prolyl oligopeptidase from porcine brain, y473f mutant

SCOP Domain Sequences for d1h2xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2xa1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa)}
mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
vfrevtvkgi

SCOP Domain Coordinates for d1h2xa1:

Click to download the PDB-style file with coordinates for d1h2xa1.
(The format of our PDB-style files is described here.)

Timeline for d1h2xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h2xa2