Lineage for d1h2vz_ (1h2v Z:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257431Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) (S)
  5. 257432Family d.58.7.1: Canonical RBD [54929] (14 proteins)
  6. 257433Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 257434Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries)
  8. 257438Domain d1h2vz_: 1h2v Z: [76595]
    Other proteins in same PDB: d1h2vc1, d1h2vc2, d1h2vc3
    mutant

Details for d1h2vz_

PDB Entry: 1h2v (more details), 2 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc)

SCOP Domain Sequences for d1h2vz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens)}
ekllkksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmkktacgfcfveyysra
daenamryingtrlddriirtdwdagfkegrqy

SCOP Domain Coordinates for d1h2vz_:

Click to download the PDB-style file with coordinates for d1h2vz_.
(The format of our PDB-style files is described here.)

Timeline for d1h2vz_: