Lineage for d1h2vz_ (1h2v Z:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2518969Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2518985Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 2518986Species Human (Homo sapiens) [TaxId:9606] [64275] (7 PDB entries)
  8. 2518987Domain d1h2vz_: 1h2v Z: [76595]
    Other proteins in same PDB: d1h2vc1, d1h2vc2, d1h2vc3
    protein/RNA complex

Details for d1h2vz_

PDB Entry: 1h2v (more details), 2 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc)
PDB Compounds: (Z:) 20 kda nuclear cap binding protein

SCOPe Domain Sequences for d1h2vz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
ekllkksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmkktacgfcfveyysra
daenamryingtrlddriirtdwdagfkegrqy

SCOPe Domain Coordinates for d1h2vz_:

Click to download the PDB-style file with coordinates for d1h2vz_.
(The format of our PDB-style files is described here.)

Timeline for d1h2vz_: