![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64275] (7 PDB entries) |
![]() | Domain d1h2vz_: 1h2v Z: [76595] Other proteins in same PDB: d1h2vc1, d1h2vc2, d1h2vc3 protein/RNA complex |
PDB Entry: 1h2v (more details), 2 Å
SCOPe Domain Sequences for d1h2vz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} ekllkksctlyvgnlsfytteeqiyelfsksgdikkiimgldkmkktacgfcfveyysra daenamryingtrlddriirtdwdagfkegrqy
Timeline for d1h2vz_: