Lineage for d1h2vc2 (1h2v C:291-480)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 216994Superfamily a.118.1: ARM repeat [48371] (12 families) (S)
  5. 217045Family a.118.1.2: HEAT repeat [48385] (3 proteins)
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 217046Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 217047Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 217058Domain d1h2vc2: 1h2v C:291-480 [76593]
    Other proteins in same PDB: d1h2vz_

Details for d1h2vc2

PDB Entry: 1h2v (more details), 2 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc)

SCOP Domain Sequences for d1h2vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2vc2 a.118.1.2 (C:291-480) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens)}
mfdytddpegpvmpgshsverfvieenlhciikshwkerktcaaqlvsypgknkiplnyh
ivevifaelfqlpapphidvmyttllielcklqpgslpqvlaqatemlymrldtmnttcv
drfinwfshhlsnfqfrwswedwsdclsqdpespkpkfvrevlekcmrlsyhqrildivp
ptfsalcpsn

SCOP Domain Coordinates for d1h2vc2:

Click to download the PDB-style file with coordinates for d1h2vc2.
(The format of our PDB-style files is described here.)

Timeline for d1h2vc2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h2vz_