SCOPe 2.06: Domain d1h2vc1: 1h2v C:29-290

Lineage for d1h2vc1 (1h2v C:29-290)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (26 families)

5. Family a.118.1.14: MIF4G domain-like [100908] (6 proteins)
   duplication: family members contains 2 or more structurally similar domains of this fold connected by unstructured linkers
   this is a repeat family; one repeat unit is 1hu3 A:905-942 found in domain

6. Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
   contains three domains of this fold connected with long linkers

7. Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)

8. Domain d1h2vc1: 1h2v C:29-290 [76592]
   Other proteins in same PDB: d1h2vz_
   protein/RNA complex

Details for d1h2vc1

PDB Entry: 1h2v, 2 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc)

PDB Compounds: (C:) 80 kda nuclear cap binding protein

SCOPe Domain Sequences for d1h2vc1:

Sequence; same for both SEQRES and ATOM records:

>d1h2vc1 a.118.1.14 (C:29-290) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
dhleslickvgeksacslesnleglagvleadlpnykskilrllctvarllpekltiytt
lvgllnarnynfggefveamirqlkeslkannyneavylvrflsdlvnchviaapsmvam
fenfvsvtqeedvpqvrrdwyvyaflsslpwvgkelyekkdaemdrifantesylkrrqk
thvpmlqvwtadkphpqeeyldclwaqiqklkkdrwqerhilrpylafdsilcealqhnl
ppftppphtedsvypmprvifr

Timeline for d1h2vc1:

• d1h2vc1 first appeared in SCOP 1.63
  
• d1h2vc1 appears in SCOPe 2.05
  
• d1h2vc1 appears in SCOPe 2.07
  
• d1h2vc1 appears in the current release, SCOPe 2.08