Lineage for d1h2uy_ (1h2u Y:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908455Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)
  7. 1908456Species Human (Homo sapiens) [TaxId:9606] [64275] (7 PDB entries)
  8. 1908465Domain d1h2uy_: 1h2u Y: [76591]
    Other proteins in same PDB: d1h2ua1, d1h2ua2, d1h2ua3, d1h2ub1, d1h2ub2, d1h2ub3
    protein/RNA complex; complexed with 7mg, gdp

Details for d1h2uy_

PDB Entry: 1h2u (more details), 2.4 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg
PDB Compounds: (Y:) 20 kda nuclear cap binding protein

SCOPe Domain Sequences for d1h2uy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2uy_ d.58.7.1 (Y:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}
llkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksg
dikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrq
ygrgrsggqvrdeyrqdydagrggygk

SCOPe Domain Coordinates for d1h2uy_:

Click to download the PDB-style file with coordinates for d1h2uy_.
(The format of our PDB-style files is described here.)

Timeline for d1h2uy_: