SCOP 1.65: Domain d1h2tz_: 1h2t Z:

Lineage for d1h2tz_ (1h2t Z:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families)

5. Family d.58.7.1: Canonical RBD [54929] (16 proteins)

6. Protein CBP20, 20KDa nuclear cap-binding protein [64274] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64275] (6 PDB entries)

8. Domain d1h2tz_: 1h2t Z: [76583]
   Other proteins in same PDB: d1h2tc1, d1h2tc2, d1h2tc3
   complexed with 7mg, gdp; mutant

Details for d1h2tz_

PDB Entry: 1h2t, 2.15 Å

PDB Description: structure of the human nuclear cap-binding-complex (cbc) in complex with a cap analogue m7gpppg

SCOP Domain Sequences for d1h2tz_:

Sequence; same for both SEQRES and ATOM records:

>d1h2tz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens)}
llkalrsdsyvelsqyrdqhfrgdneeqekllkksctlyvgnlsfytteeqiyelfsksg
dikkiimgldkmkktacgfcfveyysradaenamryingtrlddriirtdwdagfkegrq
ygrgrsggqvrdeyrqdydagrggyg

Timeline for d1h2tz_:

• d1h2tz_ first appeared in SCOP 1.63
  
• d1h2tz_ appears in SCOP 1.67
  
• d1h2tz_ appears in the current release, SCOPe 2.08