Lineage for d1h2la_ (1h2l A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234509Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 234630Superfamily b.82.2: Clavaminate synthase-like [51197] (6 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 234685Family b.82.2.6: Hypoxia-inducible factor HIF ihhibitor (FIH1) [82194] (1 protein)
  6. 234686Protein Hypoxia-inducible factor HIF ihhibitor (FIH1) [82195] (1 species)
  7. 234687Species Human (Homo sapiens) [TaxId:9606] [82196] (6 PDB entries)
  8. 234689Domain d1h2la_: 1h2l A: [76574]
    Other proteins in same PDB: d1h2ls_
    complex with HIF-1 alpha fragment peptide
    complexed with akg, fe2, so4

Details for d1h2la_

PDB Entry: 1h2l (more details), 2.25 Å

PDB Description: factor inhibiting hif-1 alpha in complex with hif-1 alpha fragment peptide

SCOP Domain Sequences for d1h2la_:

Sequence, based on SEQRES records: (download)

>d1h2la_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens)}
epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
kvaimrniekmlgealgnpqevgpllntmikgryn

Sequence, based on observed residues (ATOM records): (download)

>d1h2la_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens)}
epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpeyplkahqkva
imrniekmlgealgnpqevgpllntmikgryn

SCOP Domain Coordinates for d1h2la_:

Click to download the PDB-style file with coordinates for d1h2la_.
(The format of our PDB-style files is described here.)

Timeline for d1h2la_: