Lineage for d1h2ik_ (1h2i K:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256657Fold d.50: dsRBD-like [54767] (3 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 256658Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 256697Family d.50.1.3: The homologous-pairing domain of Rad52 recombinase [82645] (1 protein)
    contains N- and C-terminal extentions to the common fold involved in the oligomerisation
  6. 256698Protein The homologous-pairing domain of Rad52 recombinase [82646] (1 species)
    forms an undecameric ring structure; binds to ssDNA and dsDNA
  7. 256699Species Human (Homo sapiens) [TaxId:9606] [82647] (2 PDB entries)
  8. 256721Domain d1h2ik_: 1h2i K: [76560]

Details for d1h2ik_

PDB Entry: 1h2i (more details), 2.7 Å

PDB Description: human rad52 protein, n-terminal domain

SCOP Domain Sequences for d1h2ik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ik_ d.50.1.3 (K:) The homologous-pairing domain of Rad52 recombinase {Human (Homo sapiens)}
lcfgqcqytaeeyqaiqkalrqrlgpeyissrmagggqkvcyieghrvinlanemfgyng
wahsitqqnvdfvdlnngkfyvgvcafvrvqlkdgsyhedvgygvseglkskalslekar
keavtdglkralrsfgnalgncildkdylrslnklprqlplevdltkakrqdlepsveea
rynscr

SCOP Domain Coordinates for d1h2ik_:

Click to download the PDB-style file with coordinates for d1h2ik_.
(The format of our PDB-style files is described here.)

Timeline for d1h2ik_: