Lineage for d1h29c_ (1h29 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012598Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2012599Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2012600Family a.138.1.1: Cytochrome c3-like [48696] (5 protein domains)
  6. 2012601Protein 16-heme cytochrome c HmcA [81940] (1 species)
    tandem repeat of four cytochrome c3-like domains
  7. 2012602Species Desulfovibrio vulgaris [TaxId:881] [81941] (3 PDB entries)
  8. 2012606Domain d1h29c_: 1h29 C: [76548]
    complexed with hec

Details for d1h29c_

PDB Entry: 1h29 (more details), 2.51 Å

PDB Description: sulfate respiration in desulfovibrio vulgaris hildenborough: structure of the 16-heme cytochrome c hmca at 2.5 a resolution and a view of its role in transmembrane electron transfer
PDB Compounds: (C:) high-molecular-weight cytochrome c

SCOPe Domain Sequences for d1h29c_:

Sequence, based on SEQRES records: (download)

>d1h29c_ a.138.1.1 (C:) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]}
pgekradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmr
lddnsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdks
lhyrhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpal
dtaahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilp
vpgkdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqle
kamhqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveaga
llnlkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktli
agigedklaatfhiekgtlcqgchhnspasltppkcaschgkpfdadrgdrpglkaayhq
qcmgchdrmkiekpantacvdchkera

Sequence, based on observed residues (ATOM records): (download)

>d1h29c_ a.138.1.1 (C:) 16-heme cytochrome c HmcA {Desulfovibrio vulgaris [TaxId: 881]}
pgekradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmr
lddnsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdks
lhyrhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpal
dtaahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilp
vpgkdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqle
kamhqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveaga
llnlkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktli
agigedklaatfhiekgtlcqgchhnspasltppkcaschgkgdrpglkaayhqqcmgch
drmkiekpantacvdchkera

SCOPe Domain Coordinates for d1h29c_:

Click to download the PDB-style file with coordinates for d1h29c_.
(The format of our PDB-style files is described here.)

Timeline for d1h29c_: