![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (4 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47957] (18 PDB entries) |
![]() | Domain d1h28d2: 1h28 D:310-432 [76545] Other proteins in same PDB: d1h28a_, d1h28c_ complexed with tpo |
PDB Entry: 1h28 (more details), 2.8 Å
SCOP Domain Sequences for d1h28d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h28d2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)} tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet lnl
Timeline for d1h28d2:
![]() Domains from other chains: (mouse over for more information) d1h28a_, d1h28b1, d1h28b2, d1h28c_ |