SCOP 1.69: Domain d1h26c_: 1h26 C:

Lineage for d1h26c_ (1h26 C:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (79 PDB entries)

8. Domain d1h26c_: 1h26 C: [76531]
   Other proteins in same PDB: d1h26b1, d1h26b2, d1h26d1, d1h26d2
   complex with cyclin and an 11-residue recruitment peptide from p53

Details for d1h26c_

PDB Entry: 1h26, 2.24 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p53

SCOP Domain Sequences for d1h26c_:

Sequence, based on SEQRES records:

>d1h26c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records):

>d1h26c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtvvppldedgrsllsqmlh
ydpnkrisakaalahpffqdvtkpvphlr

Timeline for d1h26c_:

• d1h26c_ first appeared in SCOP 1.63
  
• d1h26c_ appears in SCOP 1.67
  
• d1h26c_ appears in SCOP 1.71
  
• d1h26c_ appears in the current release, SCOPe 2.08, called d1h26c1