Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species Human (Homo sapiens) [TaxId:9606] [88856] (417 PDB entries) Uniprot P24941 |
Domain d1h26a1: 1h26 A:1-297 [76528] Other proteins in same PDB: d1h26a2, d1h26b1, d1h26b2, d1h26c2, d1h26d1, d1h26d2 complex with cyclin and an 11-residue recruitment peptide from p53 |
PDB Entry: 1h26 (more details), 2.24 Å
SCOPe Domain Sequences for d1h26a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h26a1 d.144.1.7 (A:1-297) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
Timeline for d1h26a1: