|  | Class a: All alpha proteins [46456] (218 folds) | 
|  | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others | 
|  | Superfamily a.74.1: Cyclin-like [47954] (3 families)  duplication: consists of two domains of this fold | 
|  | Family a.74.1.1: Cyclin [47955] (4 proteins) | 
|  | Protein Cyclin A [47956] (2 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries) | 
|  | Domain d1h25b1: 1h25 B:175-309 [76523] Other proteins in same PDB: d1h25a_, d1h25c_ | 
PDB Entry: 1h25 (more details), 2.5 Å
SCOP Domain Sequences for d1h25b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h25b1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap
Timeline for d1h25b1:
|  View in 3D Domains from other chains: (mouse over for more information) d1h25a_, d1h25c_, d1h25d1, d1h25d2 |