SCOP 1.71: Domain d1h24a_: 1h24 A:

Lineage for d1h24a_ (1h24 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (80 PDB entries)

8. Domain d1h24a_: 1h24 A: [76516]
   Other proteins in same PDB: d1h24b1, d1h24b2, d1h24d1, d1h24d2

Details for d1h24a_

PDB Entry: 1h24, 2.5 Å

PDB Description: cdk2/cyclin a in complex with a 9 residue recruitment peptide from e2f

SCOP Domain Sequences for d1h24a_:

Sequence; same for both SEQRES and ATOM records:

>d1h24a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv

Timeline for d1h24a_:

• d1h24a_ first appeared in SCOP 1.63
  
• d1h24a_ appears in SCOP 1.69
  
• d1h24a_ appears in SCOP 1.73
  
• d1h24a_ appears in the current release, SCOPe 2.08, called d1h24a1