SCOPe 2.05: Domain d1h21c_: 1h21 C:

Lineage for d1h21c_ (1h21 C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Dimeric di-heme split-soret cytochrome c [48716] (1 species)

7. Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48717] (1 PDB entry)

8. Domain d1h21c_: 1h21 C: [76512]
   complexed with hec

Details for d1h21c_

PDB Entry: 1h21, 2.5 Å

PDB Description: a novel iron centre in the split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774

PDB Compounds: (C:) split-soret cytochrome c

SCOPe Domain Sequences for d1h21c_:

Sequence; same for both SEQRES and ATOM records:

>d1h21c_ a.138.1.3 (C:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}
grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp

Timeline for d1h21c_:

• d1h21c_ first appeared in SCOP 1.63
  
• d1h21c_ appears in SCOPe 2.04
  
• d1h21c_ appears in SCOPe 2.06
  
• d1h21c_ appears in the current release, SCOPe 2.08