Lineage for d1h21c_ (1h21 C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 218289Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 218290Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 218357Family a.138.1.3: Di-heme elbow motif [48711] (6 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 218377Protein Dimeric di-heme split-soret cytochrome c [48716] (1 species)
  7. 218378Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48717] (1 PDB entry)
  8. 218381Domain d1h21c_: 1h21 C: [76512]

Details for d1h21c_

PDB Entry: 1h21 (more details), 2.5 Å

PDB Description: a novel iron centre in the split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774

SCOP Domain Sequences for d1h21c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h21c_ a.138.1.3 (C:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774}
grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp

SCOP Domain Coordinates for d1h21c_:

Click to download the PDB-style file with coordinates for d1h21c_.
(The format of our PDB-style files is described here.)

Timeline for d1h21c_: