Lineage for d1h21b_ (1h21 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1283685Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 1283686Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 1283808Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 1283836Protein Dimeric di-heme split-soret cytochrome c [48716] (1 species)
  7. 1283837Species Desulfovibrio desulfuricans, ATCC 27774 [TaxId:876] [48717] (1 PDB entry)
  8. 1283839Domain d1h21b_: 1h21 B: [76511]
    complexed with hec

Details for d1h21b_

PDB Entry: 1h21 (more details), 2.5 Å

PDB Description: a novel iron centre in the split-soret cytochrome c from desulfovibrio desulfuricans atcc 27774
PDB Compounds: (B:) split-soret cytochrome c

SCOPe Domain Sequences for d1h21b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h21b_ a.138.1.3 (B:) Dimeric di-heme split-soret cytochrome c {Desulfovibrio desulfuricans, ATCC 27774 [TaxId: 876]}
grfdqvggafgwkphkldpkecaqvaydgywykgfgcgfgafysivglmgekygapynqf
pfamleankggisdwgticgalygaaatfslfwgrkevhpmvnelfrwyevtklpifnpg
daaqgvkgdlpmsasdsvlchisvskwcyenkieatskqrsercgrltadaafkaaeiin
tkidqgkdfkstfpmqasvsscgechmtkgndanwakgimdctpchsgtaatqnkfvnhp

SCOPe Domain Coordinates for d1h21b_:

Click to download the PDB-style file with coordinates for d1h21b_.
(The format of our PDB-style files is described here.)

Timeline for d1h21b_: