![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) ![]() |
![]() | Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) |
![]() | Protein D-ribulose-5-phosphate 3-epimerase [51373] (2 species) |
![]() | Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries) |
![]() | Domain d1h1zb_: 1h1z B: [76509] complexed with so4, zn |
PDB Entry: 1h1z (more details), 3.4 Å
SCOP Domain Sequences for d1h1zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1zb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa)} aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps tidvaasagancivagssifgaaepgevisalrksvegsq
Timeline for d1h1zb_: