Lineage for d1h1zb_ (1h1z B:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) 
Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) Protein D-ribulose-5-phosphate 3-epimerase [51373] (2 species) Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries) 
Domain d1h1zb_: 1h1z B: [76509]
complexed with so4, zn
Details for d1h1zb_
PDB Entry: 1h1z (more details), 3.4 Å
PDB Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate and zinc
SCOP Domain Sequences for d1h1zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1zb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa)}
aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
tidvaasagancivagssifgaaepgevisalrksvegsq
SCOP Domain Coordinates for d1h1zb_:
Click to download the PDB-style file with coordinates for d1h1zb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h1zb_:
- d1h1zb_ is new in SCOP 1.63
- d1h1zb_ appears in SCOP 1.65
- d1h1zb_ appears in the current release, SCOPe 2.08
View in 3D
