Lineage for d1h1za_ (1h1z A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968402Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 968451Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 968452Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 968460Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries)
  8. 968463Domain d1h1za_: 1h1z A: [76508]
    complexed with so4, zn

Details for d1h1za_

PDB Entry: 1h1z (more details), 3.4 Å

PDB Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate and zinc
PDB Compounds: (A:) d-ribulose-5-phosphate 3-epimerase

SCOPe Domain Sequences for d1h1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1za_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]}
aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
tidvaasagancivagssifgaaepgevisalrksvegsq

SCOPe Domain Coordinates for d1h1za_:

Click to download the PDB-style file with coordinates for d1h1za_.
(The format of our PDB-style files is described here.)

Timeline for d1h1za_: