Lineage for d1h1za_ (1h1z A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570444Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 570445Protein D-ribulose-5-phosphate 3-epimerase [51373] (4 species)
  7. 570453Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries)
  8. 570456Domain d1h1za_: 1h1z A: [76508]

Details for d1h1za_

PDB Entry: 1h1z (more details), 3.4 Å

PDB Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate and zinc

SCOP Domain Sequences for d1h1za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1za_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa)}
aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
tidvaasagancivagssifgaaepgevisalrksvegsq

SCOP Domain Coordinates for d1h1za_:

Click to download the PDB-style file with coordinates for d1h1za_.
(The format of our PDB-style files is described here.)

Timeline for d1h1za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1h1zb_