SCOP 1.75: Domain d1h1yb_: 1h1y B:

Lineage for d1h1yb_ (1h1y B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)

6. Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries)

8. Domain d1h1yb_: 1h1y B: [76507]
   complexed with so4

Details for d1h1yb_

PDB Entry: 1h1y, 1.87 Å

PDB Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate

PDB Compounds: (B:) d-ribulose-5-phosphate 3-epimerase

SCOP Domain Sequences for d1h1yb_:

Sequence; same for both SEQRES and ATOM records:

>d1h1yb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]}
aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
tidvaasagancivagssifgaaepgevisalrksvegsq

Timeline for d1h1yb_:

• d1h1yb_ first appeared in SCOP 1.63
  
• d1h1yb_ appears in SCOP 1.73
  
• d1h1yb_ appears in SCOPe 2.01
  
• d1h1yb_ appears in the current release, SCOPe 2.08