![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (2 proteins) automatically mapped to Pfam PF00834 |
![]() | Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species) |
![]() | Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries) |
![]() | Domain d1h1yb_: 1h1y B: [76507] complexed with so4 |
PDB Entry: 1h1y (more details), 1.87 Å
SCOPe Domain Sequences for d1h1yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1yb_ c.1.2.2 (B:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps tidvaasagancivagssifgaaepgevisalrksvegsq
Timeline for d1h1yb_: