SCOPe 2.01: Domain d1h1ya_: 1h1y A:

Lineage for d1h1ya_ (1h1y A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)

6. Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [82238] (2 PDB entries)

8. Domain d1h1ya_: 1h1y A: [76506]
   complexed with so4

Details for d1h1ya_

PDB Entry: 1h1y, 1.87 Å

PDB Description: the structure of the cytosolic d-ribulose-5-phosphate 3-epimerase from rice complexed with sulfate

PDB Compounds: (A:) d-ribulose-5-phosphate 3-epimerase

SCOPe Domain Sequences for d1h1ya_:

Sequence; same for both SEQRES and ATOM records:

>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]}
aakiapsmlssdfanlaaeadrmvrlgadwlhmdimdghfvpnltigapviqslrkhtka
yldchlmvtnpsdyveplakagasgftfhievsrdnwqeliqsikakgmrpgvslrpgtp
veevfplveaenpvelvlvmtvepgfggqkfmpemmekvralrkkypsldievdgglgps
tidvaasagancivagssifgaaepgevisalrksvegsq

Timeline for d1h1ya_:

• d1h1ya_ first appeared in SCOP 1.63
  
• d1h1ya_ appears in SCOP 1.75
  
• d1h1ya_ appears in SCOPe 2.02
  
• d1h1ya_ appears in the current release, SCOPe 2.08