SCOPe 2.07: Domain d1h1vg3: 1h1v G:629-742

Lineage for d1h1vg3 (1h1v G:629-742)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
   Uniprot P20065 55-179

8. Domain d1h1vg3: 1h1v G:629-742 [76505]
   Other proteins in same PDB: d1h1va1, d1h1va2
   domains 4, 5 and 6
   complexed with atp, ca

Details for d1h1vg3

PDB Entry: 1h1v, 3 Å

PDB Description: gelsolin g4-g6/actin complex

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1h1vg3:

Sequence; same for both SEQRES and ATOM records:

>d1h1vg3 d.109.1.1 (G:629-742) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
rlkdkkmdahpprlfacsnkigrfvieevpgelmqedlatddvmlldtwdqvfvwvgkds
qeeektealtsakryietdpanrdrrtpitvvkqgfeppsfvgwflgwdddyws

Timeline for d1h1vg3:

• d1h1vg3 first appeared in SCOP 1.63
  
• d1h1vg3 appears in SCOPe 2.06
  
• d1h1vg3 appears in the current release, SCOPe 2.08