Lineage for d1h1sd2 (1h1s D:310-432)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283121Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 283122Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 283123Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 283128Protein Cyclin A [47956] (2 species)
  7. 283132Species Human (Homo sapiens) [TaxId:9606] [47957] (18 PDB entries)
  8. 283140Domain d1h1sd2: 1h1s D:310-432 [76500]
    Other proteins in same PDB: d1h1sa_, d1h1sc_
    complexed with 4sp, tpo

Details for d1h1sd2

PDB Entry: 1h1s (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6102

SCOP Domain Sequences for d1h1sd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1sd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1h1sd2:

Click to download the PDB-style file with coordinates for d1h1sd2.
(The format of our PDB-style files is described here.)

Timeline for d1h1sd2: