Lineage for d1h1sa_ (1h1s A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874554Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 874564Species Human (Homo sapiens) [TaxId:9606] [88856] (128 PDB entries)
    Uniprot P24941
  8. 874641Domain d1h1sa_: 1h1s A: [76495]
    Other proteins in same PDB: d1h1sb1, d1h1sb2, d1h1sd1, d1h1sd2

Details for d1h1sa_

PDB Entry: 1h1s (more details), 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6102
PDB Compounds: (A:) Cell division protein kinase 2

SCOP Domain Sequences for d1h1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1sa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

SCOP Domain Coordinates for d1h1sa_:

Click to download the PDB-style file with coordinates for d1h1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1h1sa_: