SCOP 1.75: Domain d1h1rc_: 1h1r C:

Lineage for d1h1rc_ (1h1r C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (128 PDB entries)
   Uniprot P24941

8. Domain d1h1rc_: 1h1r C: [76492]
   Other proteins in same PDB: d1h1rb1, d1h1rb2, d1h1rd1, d1h1rd2
   complexed with 6cp, tpo

Details for d1h1rc_

PDB Entry: 1h1r, 2 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu6086

PDB Compounds: (C:) Cell division protein kinase 2

SCOP Domain Sequences for d1h1rc_:

Sequence; same for both SEQRES and ATOM records:

>d1h1rc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d1h1rc_:

• d1h1rc_ first appeared in SCOP 1.63
  
• d1h1rc_ appears in SCOP 1.73
  
• d1h1rc_ appears in SCOPe 2.01
  
• d1h1rc_ appears in the current release, SCOPe 2.08, called d1h1rc1