| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [88856] (73 PDB entries) |
| Domain d1h1qa_: 1h1q A: [76483] Other proteins in same PDB: d1h1qb1, d1h1qb2, d1h1qd1, d1h1qd2 |
PDB Entry: 1h1q (more details), 2.5 Å
SCOP Domain Sequences for d1h1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1qa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
Timeline for d1h1qa_: