Lineage for d1h1pc_ (1h1p C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734916Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 734926Species Human (Homo sapiens) [TaxId:9606] [88856] (124 PDB entries)
  8. 734996Domain d1h1pc_: 1h1p C: [76480]
    Other proteins in same PDB: d1h1pb1, d1h1pb2, d1h1pd1, d1h1pd2
    complexed with cmg, tpo

Details for d1h1pc_

PDB Entry: 1h1p (more details), 2.1 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with the inhibitor nu2058
PDB Compounds: (C:) Cell division protein kinase 2

SCOP Domain Sequences for d1h1pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1pc_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

SCOP Domain Coordinates for d1h1pc_:

Click to download the PDB-style file with coordinates for d1h1pc_.
(The format of our PDB-style files is described here.)

Timeline for d1h1pc_: